Shri Radha Sudha Nidhi, shloka 130
Verse 130 of the Shri Radha Sudha Nidhi, the Sanskrit hymn to Shri Radha by Shri Hit Harivansh Mahaprabhu, founder of the Radhavallabh Sampradaya. Below: the verse in Devanagari, in English letters, and what it says.
The verse in full
प्रेमोल्लासैकसीमा परमरसचमत्कारवैचित्र्यसीमा
सौन्दर्यस्यैकसीमा किमपि नववयोरूपलावण्यसीमा ।
लीलामाधुर्यसीमा निजजनपरमोदारवात्सल्यसीमा
सा राधा सौख्यसीमा जयति रतिकलाकेलिमाधुर्यसीमा ॥ १३० ॥
In Roman letters
premollaasaikaseemaa paramarasachamatkaaravaichitryaseemaa
saundaryasyaikaseemaa kimapi navavayoroopalaavanyaseemaa
leelaamaadhuryaseemaa nijajanaparamodaaravaatsalyaseemaa
saa raadhaa saukhyaseemaa jayati ratikalaakelimaadhuryaseemaa
What it means
The limit of love's joy, of wonder, of beauty, of youth and grace, of playful sweetness, of generosity and affection to her own people, and of happiness and love's art: glory to Radha, the furthest limit of all.
Things devotees often ask about
Radha Kripa Kataksh Stotra, Arth Sahit
A small paath book with the stotra and its Hindi meaning, easy to keep on the home altar.
Tulsi Japa Mala, 108 Beads
A plain tulsi mala with 7 mm beads, the size most people find comfortable for daily japa.
Brass Lotus Diya, Set of 2
Two small lotus-shaped brass diyas for the home mandir, for daily aarti or deep daan.
As an Amazon Associate we earn from qualifying purchases; your price does not change. None of this is needed for the practice, and none of it is connected with Maharaj Ji or the ashram. See all items
Questions about shloka 130
What does Radha Sudha Nidhi shloka 130 mean?
The limit of love's joy, of wonder, of beauty, of youth and grace, of playful sweetness, of generosity and affection to her own people, and of happiness and love's art: glory to Radha, the furthest limit of all. The full meaning is given above, under the verse.
How is shloka 130 pronounced?
In English letters: premollaasaikaseemaa paramarasachamatkaaravaichitryaseemaa / saundaryasyaikaseemaa kimapi navavayoroopalaavanyaseemaa / leelaamaadhuryaseemaa nijajanaparamodaaravaatsalyaseemaa / saa raadhaa saukhyaseemaa jayati ratikalaakelimaadhuryaseemaa
Who wrote the Radha Sudha Nidhi?
Shri Hit Harivansh Mahaprabhu, founder of the Radhavallabh Sampradaya, the tradition into which Premanand Ji Maharaj took diksha. It is a Sanskrit stotra of about 270 verses addressed to Shri Radha.
Where is this text taken from?
We typeset it ourselves and checked every verse against a 1950 Radhavallabh edition in the public domain. Where copies differ, that edition's reading is used.