Shri Radha Sudha Nidhi, shloka 101
Verse 101 of the Shri Radha Sudha Nidhi, the Sanskrit hymn to Shri Radha by Shri Hit Harivansh Mahaprabhu, founder of the Radhavallabh Sampradaya. Below: the verse in Devanagari, in English letters, and what it says.
The verse in full
लज्जान्तःपटमारचय्य रचितस्मायप्रसूनाञ्जलौ
राधाङ्गे नवरङ्गधाम्नि ललितप्रस्तावने यौवने ।
श्रोणीहेमवरासने स्मरनृपेणाध्यासिते मोहने
लीलापाङ्गविचित्रताण्डवकलापाण्डित्यमुन्मीलति ॥ १०१ ॥
In Roman letters
lajjaantahpatamaarachayya rachitasmaayaprasoonaanjalau
raadhaange navarangadhaamni lalitaprastaavane yauvane
shroneehemavaraasane smaranripenaadhyaasite mohane
leelaapaangavichitrataandavakalaapaandityamunmeelati
What it means
In the newly blossomed form of Radha, where youth's lovely prelude begins behind a curtain of shyness and smiles are offered like flowers, Kamadeva sits on a golden throne, and her playful glances show a mastery of the art of dance.
Things devotees often ask about
Radha Kripa Kataksh Stotra, Arth Sahit
A small paath book with the stotra and its Hindi meaning, easy to keep on the home altar.
Tulsi Japa Mala, 108 Beads
A plain tulsi mala with 7 mm beads, the size most people find comfortable for daily japa.
Brass Lotus Diya, Set of 2
Two small lotus-shaped brass diyas for the home mandir, for daily aarti or deep daan.
As an Amazon Associate we earn from qualifying purchases; your price does not change. None of this is needed for the practice, and none of it is connected with Maharaj Ji or the ashram. See all items
Questions about shloka 101
What does Radha Sudha Nidhi shloka 101 mean?
In the newly blossomed form of Radha, where youth's lovely prelude begins behind a curtain of shyness and smiles are offered like flowers, Kamadeva sits on a golden throne, and her playful glances show a mastery of the art of dance. The full meaning is given above, under the verse.
How is shloka 101 pronounced?
In English letters: lajjaantahpatamaarachayya rachitasmaayaprasoonaanjalau / raadhaange navarangadhaamni lalitaprastaavane yauvane / shroneehemavaraasane smaranripenaadhyaasite mohane / leelaapaangavichitrataandavakalaapaandityamunmeelati
Who wrote the Radha Sudha Nidhi?
Shri Hit Harivansh Mahaprabhu, founder of the Radhavallabh Sampradaya, the tradition into which Premanand Ji Maharaj took diksha. It is a Sanskrit stotra of about 270 verses addressed to Shri Radha.
Where is this text taken from?
We typeset it ourselves and checked every verse against a 1950 Radhavallabh edition in the public domain. Where copies differ, that edition's reading is used.